################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:28:23 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Alpha_adaptinC12.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1e42a.pdb # 2: 1qtsa.pdb # # Length: 275 # Identity: 32/275 ( 11.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/275 ( 11.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 70/275 ( 25.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1e42a.pdb 1 GGYVA--------------------PKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTN 40 1qtsa.pdb 1 -----GSPGIRLGSSEDNFARFVCKNNGVLFE--N-QLLQIGLKSEFRQNLGRMFIFYGN 52 V L I RQ M N 1e42a.pdb 41 KALQHMTDFAIQFNKNS------FGVIPS-TPLAIHTPLMPNQSIDVSLPLNTLGPVMKM 93 1qtsa.pdb 53 KTSTQFLNFTPTLIC--ADDLQTNLNLQTKPVD---PTVDGGAQVQQVVNIECI---SDF 104 K F 1e42a.pdb 94 EPLNNLQVAVKNNIDVFYFSCLIPL--NVLFVEDG-KMERQVFLATWKDIP-NENELQFQ 149 1qtsa.pdb 105 TEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQ--PTEMASQDFFQRWKQLSNPQQEVQNI 162 L S P N F M Q F WK E Q 1e42a.pdb 150 IKEC--HLNADTVSSKLQNNNVYTIA-KRNVEGQ----DMLYQSLKLT----NGIWILAE 198 1qtsa.pdb 163 FK-AKHPMDTEITKAKIIGFGSALLEEV------DPNPANFVGAGIIHTKTTQ-IGCLLR 214 K K I L 1e42a.pdb 199 LRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN 233 1qtsa.pdb 215 LEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF-- 247 L Y L L VSQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################