################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:47:40 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Asn_synthase.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ct9a.pdb # 2: 1jgta.pdb # # Length: 331 # Identity: 59/331 ( 17.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/331 ( 17.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 66/331 ( 19.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ct9a.pdb 1 RDWFDYDAV--K-DN-VT----DKNELRQALEDSVKSHLMSDVPYGVLLSGGLDSSIISA 52 1jgta.pdb 1 ---------TPGLSRRILPEGEAVAAVRAALEKAVAQRVTPGDTPLVVLSGGIDSSGVAA 51 R ALE V V LSGG DSS A 1ct9a.pdb 53 ITKKYA--LHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETY 110 1jgta.pdb 52 CAHRAAGELDTVSMGTDTSNEFREARAVVDHLRTRHREITIPTTELLAQLPYAVWASESV 111 A L G S A V HL T H EI E L E 1ct9a.pdb 111 DVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLYFHKAP---NAKELHEETVR 167 1jgta.pdb 112 DPDIIEYLLPLTALYRALD-GPERRILTGYGADIPLGGMH------REDRLPALDTVLAH 164 D I P R L G G D GG L 1ct9a.pdb 168 KLLALHMYDCAR--ANKAMSAWGVEARVPFLDKKFLDVAMRINPQDKM-CKMEKHILREC 224 1jgta.pdb 165 DMATFDGLN---EMSPVLSTLAGHWTTHPYWDREVLDLLVSLEAGLKRRHGRDKWVLRAA 221 G P D LD K K LR 1ct9a.pdb 225 FEAYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQV--SDQQLETARFRFPYNTPTSKE 282 1jgta.pdb 222 MADALPAETVNRPKL----------S-SFSRLLLDHGVAEDRVHEAKRQVV------REL 264 LPA R K D E R 1ct9a.pdb 283 AYLYREI--------FEELFPLPSAAECVPG 305 1jgta.pdb 265 FDLTVGGGRHPSEVDTDDVVR-SVADRT--- 291 L A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################