################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Mon Jul 25 15:11:36 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Cucumo_coat.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1f15a.pdb # 2: 1laja.pdb # # Length: 177 # Identity: 75/177 ( 42.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 75/177 ( 42.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/177 ( 13.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1f15a.pdb 1 ------------------ERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKL 42 1laja.pdb 1 NIASSSAPSLQHPTFIASKKCRAGYTYTSLDVRPTRTEKDKSFGQRLIIPVPVSEYPKKK 60 CR GYT TS P G RL P V EY KK 1f15a.pdb 43 VSRLQIRVNPLPKFDSTVWVTVRKVPASSDL-SVAAISAMFADGASPVLVYQY-AASGVQ 100 1laja.pdb 61 VSCVQVRLNPSPKFNSTIWVSLRRLD-ETTLLTSENVFKLFTD-GLAVLIYQHVPTG-IQ 117 VS Q R NP PKF ST WV R L F D VL YQ Q 1f15a.pdb 101 ANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV 157 1laja.pdb 118 PNNKITFDMSNVGAEIGDMGKYALIVYSKDDVLEADEMVIHIDIEHQRIPSASTLPV 174 NNK D S A IGDM KYA VYSKDD LE DE V H DIEHQRIP LPV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################