################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:14:22 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Cutinase.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bs9.pdb # 2: 1cex.pdb # # Length: 244 # Identity: 30/244 ( 12.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/244 ( 12.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 84/244 ( 34.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bs9.pdb 1 -------------SCPAIHVFGARETTASPGYG-SSSTVVNGVLSAYP-G-STAEAINYP 44 1cex.pdb 1 RTTRDDLINGNSASCADVIFIYARGSTETGNLGTLGPSIASNLESAFGKDGVWIQGVG-G 59 SC AR T G SA 1bs9.pdb 45 ACGGQSSCGGASY-SSS-------VAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIM 96 1cex.pdb 60 ---------AYRATLGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQGAALA 110 I N CP GYSQG 1bs9.pdb 97 DVALCGGGDPNQGYTNTAVQLSSSAVNMVKAAIFMGDPMFRAGLSYEVGTCAAGGFDQRP 156 1cex.pdb 111 AASI--------------EDLDSAIRDKIAGTVLFGYTKNL-----------QNR----- 140 L S G 1bs9.pdb 157 AGFSCP--SAAKIKSYCDASDPYCCNGSNAATHQGY-----GSE-YGSQALAFVKSKLG- 207 1cex.pdb 141 --GRIPNYPADRTKVFCNTGDLVCTGSLIVA-----APHLAYGPDARGPAPEFLIEKVRA 193 P A K C D C A A F K 1bs9.pdb ---- 1cex.pdb 194 VRGS 197 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################