################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:38:10 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/DSBA.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bed.pdb # 2: 1fvka.pdb # # Length: 191 # Identity: 70/191 ( 36.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 70/191 ( 36.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/191 ( 6.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bed.pdb 1 AQFKEGEHYQVLKTPASSSP-VVSEFFSFYCPHCNTFE---PIIAQLKQQLPEGAKFQKN 56 1fvka.pdb 1 AQYEDGKQYTTLEKPV-AGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKY 59 AQ G Y L P V EFFSF CPHC FE I K LPEG K K 1bed.pdb 57 HVSFMGGNMGQAMSKAYATMIALEVEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGID 116 1fvka.pdb 60 HVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQT-IRSASDIRDVFINAGIK 118 HV FMGG G A A AL VEDK F R F GI 1bed.pdb 117 AAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQGQSVK------SLDEY 170 1fvka.pdb 119 GEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQY 178 DAA N F V S V K D L GVPA VN Y Q Y 1bed.pdb 171 FDLVNYLLTLK 181 1fvka.pdb 179 ADTVKYLSEK- 188 D V YL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################