################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:20:00 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Dala_Dala_ligas_C.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ehia.pdb # 2: 1iow.pdb # # Length: 233 # Identity: 55/233 ( 23.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/233 ( 23.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 28/233 ( 12.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ehia.pdb 1 DKALTKELLTVNGIRNTKYIVVDPESAN-NW---SWDKIVAELGNIVFVKAANQGSSVGI 56 1iow.pdb 1 KLR-SKLLWQGAGLPVAPWVALTRAEFEKGLSDKQLAEI-SALGLPVIVKPSREGSSVGM 58 K L G I LG V VK GSSVG 1ehia.pdb 57 SRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIGAHTVPNQGS 116 1iow.pdb 59 SKVVAENALQDALRLAFQHDEEVLIEKWLSGPEFTVAILG----EEILPSIRIQPS---- 110 S V AL FQ D VLIE G 1ehia.pdb 117 GDG-WYDYNNKFVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDEN 175 1iow.pdb 111 --GTFYDYEAKF-LSDETQYFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSD 167 G YDY KF PA L L A L G R D LD 1ehia.pdb 176 NVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDYGFEDFAQNKKLS 228 1iow.pdb 168 GQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRILELAD---------- 210 YL E NT PG T SL LV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################