################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Mon Jul 25 15:13:10 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Exonuclease.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1fxxa.pdb # 2: 1j54a.pdb # # Length: 200 # Identity: 32/200 ( 16.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/200 ( 16.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 36/200 ( 18.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1fxxa.pdb 1 QSTFLFHDYETFGT------HPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQP 54 1j54a.pdb 1 --RQIVLDTETTGMNQIGAHY-EGHKIIEIGAVEVVNR-RLTGNNFHVYLKPD--RLVDP 54 D ET G A G Y KP L P 1fxxa.pdb 55 GAVLITGITPQEARAKGENEAAFAARIHSLFTVPKTCILGY-NNVRFDDEVTRNIFYRNF 113 1j54a.pdb 55 EAFGVHGIADEFLLDKPT-FAEVADEFMDYIR--GAELVI-HN-AAFDIGFMDYEFSLLK 109 A GI K A A N FD F 1fxxa.pdb 114 YDPY-AWSWQHDNSRWDLLDVMRACYALRPEGINWPEGLPSFRLEHLTKANGIEH-SN-A 170 1j54a.pdb 110 RDIPKTNT---FCKVTDSLAVARKMFP-----------GKRNSLDALCARYEIDNSKRTL 155 D D L V R L L I 1fxxa.pdb 171 HDAMADVYATIAMAKLVKTR 190 1j54a.pdb 156 HGALLDAQILAEVYLAMTG- 174 H A D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################