################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:00:41 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/FYVE.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1dvpa.pdb # 2: 1vfya.pdb # # Length: 67 # Identity: 29/ 67 ( 43.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 67 ( 43.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 67 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1dvpa.pdb 1 NWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAA 60 1vfya.pdb 1 DWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFED 60 W D C C F NRKHHCR CG VFC PLP GI VRVCD CF 1dvpa.pdb 61 LQRG--- 64 1vfya.pdb 61 YEFIVTD 67 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################