################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:30:11 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/GTP_cyclohydroI.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1fb1a.pdb # 2: 1fbxa.pdb # # Length: 225 # Identity: 68/225 ( 30.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 68/225 ( 30.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/225 ( 14.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1fb1a.pdb 1 -----------------GERPRSEE------DNELNLPNLAAAYSSILSSLGENPQRQGL 37 1fbxa.pdb 1 PSLSKEAALVHEALVARGLETPLR-PPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL 59 G DNE A I L L 1fb1a.pdb 38 LKTPWRAASAMQ-FFTKGYQE--TISDVL-NDAIFDEDHDEMVIVKDIDMFSMCEHHLVP 93 1fbxa.pdb 60 METPHRIAKMYVDEIFSGLDYANFPK---ITLIENKMKVDEMVTVRDITLTSTCEHHFVT 116 TP R A G DEMV V DI S CEHH V 1fb1a.pdb 94 FVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVE 153 1fbxa.pdb 117 IDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSID 176 GK Y P V GLSK RIV R QVQERLT QI A L V V 1fb1a.pdb 154 ATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS-- 196 1fbxa.pdb 177 AVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN 221 A H C RG S T T G F TR EFL R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################