################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 02:24:17 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Glyco_hydro_2.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1bhga.pdb # 2: 1dp0a1.pdb # 3: 1dp0a2.pdb # # Length: 135 # Identity: 3/135 ( 2.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/135 ( 22.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 54/135 ( 40.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bhga.pdb 1 TYIDDITVTTSVEQ-D-SGLVNYQISVKGS--NLFKLEVRLLDA-ENKVVANGTG----- 50 1dp0a1.pdb 1 TQISDFHVATRFNDDFSRAVLEAEVQMCGE--LRDYLRVTVSLWQGETQVASGTAPFGGE 58 1dp0a2.pdb 1 ----FFQFRLSG--------QTIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVA 48 df v ts ev g d l v a k vAsGt 1bhga.pdb 51 ----------TQGQLKVPG--VSLWWPYLMHERPAYLYSLEVQLTA-QTS---L-GPVSD 93 1dp0a1.pdb 59 IIDERGGYA-DRVTLRLNVENPKLWSAE-----IPNLYRAVVELHT--A----DGTL-IE 105 1dp0a2.pdb 49 --------PQGKQLIELPE--LPQPES-----AGQLWLTVRVV-QPNATAWSEAGHI-SA 91 l lp lw ly V t s 1bhga.pdb 94 FYTLPVGI----RT- 103 1dp0a1.pdb 106 AEACDVGF----R-- 114 1dp0a2.pdb 92 WQQWRLAENLSV-TL 105 vg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################