################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:20:17 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Glyco_hydro_2_N.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bhga.pdb # 2: 1dp0a.pdb # # Length: 251 # Identity: 29/251 ( 11.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/251 ( 11.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 91/251 ( 36.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bhga.pdb 1 G--------------LQGGMLYPQESP------------SRECKELDGLWSFRADFSDNR 34 1dp0a.pdb 1 -RRDWENPGVTQLNRL-AAHPPFASWRNSEEARTDRPSQQ-LRS-LNGEWRFAWFP---- 52 L L G W F 1bhga.pdb 35 R-RGFEE-QWYRRPLWESGPTVDMPVPSSFNDISQD------WRLR-H--------FV-G 76 1dp0a.pdb 53 -APEAVPESWLECDLP---EADTVVVPSNWQMHG-YDAPIYTNVTYPITVNPPFVPTENP 107 W L VPS 1bhga.pdb 77 WVWYEREVILPERWTQDLRTRVVLRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLV 136 1dp0a.pdb 108 TGCYSLTFNVDESWL-Q-EGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFD----L 161 Y E W S W NG LP E D 1bhga.pdb 137 QVGPLP-SRLRITIAINNTLTPTTLPPGTIQYLTDTSKY--PKGYFVQNTYFDFFNYAGL 193 1dp0a.pdb 162 SAFLR-AGENRLAVMVLR-WSD-----------------GSYLE------DQDMWRMSGI 196 R D G 1bhga.pdb 194 QRSVLLYTTPT 204 1dp0a.pdb 197 FRDVSLLHKPT 207 R V L PT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################