################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:35:14 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Histidine_kinase.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1b3qa.pdb # 2: 1bxda.pdb # # Length: 219 # Identity: 27/219 ( 12.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/219 ( 12.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 102/219 ( 46.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1b3qa.pdb 1 MV----------PISFVFNRFPRMVRDLAKKMNK-EVNFIMRG-EDT-ELDRTFVEEIGE 47 1bxda.pdb 1 --TGQEMPMEMADLNAVLGEVIAAESG-------YEREIETALYPGSIEVKM-HPLSIKR 50 V E E I 1b3qa.pdb 48 PLLHLLRNAIDHGIEPKEERIAKGKPPIGTLILSARHEGNNVVIEVEDDGRGIDKEKIIR 107 1bxda.pdb 51 AVANMVVNAARYGN--------------GWIKVSSGTEPNRAWFQVEDDGPGIA------ 90 NA G G S E N VEDDG GI 1b3qa.pdb 108 KAIEKGLIDESKAATLSDQEILNFLFVPGFSGVGM--------------------DVVKN 147 1bxda.pdb 91 ------------------PEQRKHL----------FQPFVRGDSARTISGTGLGLAIVQR 122 E L V 1b3qa.pdb 148 VVESLNGSMGIESEKDKGTKVTIRLPLT----------- 175 1bxda.pdb 123 IVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG 161 V NG G LP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################