################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:43:09 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/IFN-gamma.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1d9ca.pdb # 2: 1fyha1.pdb # # Length: 126 # Identity: 71/126 ( 56.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 71/126 ( 56.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/126 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1d9ca.pdb 1 Q--GQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWKDESDKKIIQSQIVSFYFKLFE 58 1fyha1.pdb 1 -MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFK 59 E ENLK YFNA DVA G LF ILKNWK ESD KI QSQIVSFYFKLF 1d9ca.pdb 59 NLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVMN 118 1fyha1.pdb 60 NFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIDELIQVMA 119 N KD Q IQ S IK DM KF N K DF KL V DL QRKAI ELI VM 1d9ca.pdb 119 DLS--- 121 1fyha1.pdb 120 ELGANV 125 L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################