################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 02:40:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Invasin.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1cwva1.pdb # 2: 1cwva2.pdb # 3: 1cwva3.pdb # # Length: 107 # Identity: 9/107 ( 8.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/107 ( 40.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/107 ( 18.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1cwva1.pdb 1 ----TIAADKSTLAAVPTSIIADGLMASTITLELKDTYGDPQAGAN-VAFDTTL-G-NM- 52 1cwva2.pdb 1 -ADPIPDAGRSSFTVSTPDILADGTMSSTLSFVPVDKNGHFISGMQGLSFTQNGVPVSI- 58 1cwva3.pdb 1 L--------TLTAAVIGDGAPANGKTAITVEFTVADFEGKPLAGQE-VVITTNNGA-LPN 50 st av i AdG masT f D G p aG v fttn 1cwva1.pdb 53 -GVITDHNDGTYSAPLTSTTLGVATVTVKVDGAAFSVPSVTVNFT-- 96 1cwva2.pdb 59 -SPITEQ-PDSYTATVVGNSVGDVTITPQVDTLILSTLQKKISLFPV 103 1cwva3.pdb 51 KITEKTDANGVARIALTNTTDGVTVVTAEVEGQRQ---SVDTHFVKG 94 it g y a lt tt Gv tvT Vdg sv f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################