################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:14:08 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Peptidase_S11.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1hd8a.pdb # 2: 1skf.pdb # # Length: 277 # Identity: 75/277 ( 27.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 75/277 ( 27.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 49/277 ( 17.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1hd8a.pdb 1 LNIKTMIPGVPQIDAESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGK 60 1skf.pdb 1 -------VTKPTIAAVGGYAMNNGTGTTLYTKAADTRRSTGSTTKIMTAKVVLAQ----S 49 P I A G L AD RR S TK MT V 1hd8a.pdb 61 -FKETDLVTIGN---------------LKPGMQVPVSQLIRDINLQSGNDACVAMADFAA 104 1skf.pdb 50 NLNLDAKVTIQKAYSDYVVANNASQAHLIVGDKVTVRQLLYGLMLPSGCDAAYALADKYG 109 VTI L G V V QL L SG DA A AD 1hd8a.pdb 105 G-------SQDAFVGLMNSYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDV 157 1skf.pdb 110 SGSTRAARV-KSFIGKMNTAATNLGLHNTHFDSFDGIGNGANYSTPRDLTKIASSAMK-N 167 F G MN LGL NTHF G YS RD I 1hd8a.pdb 158 PNEYSIYKEKEFTFN---------G-IRQLNRNGLLWDNS-LNVDGIKTGHTDKAGYNLV 206 1skf.pdb 168 STFRTVVKTKAYTAKTVTKTGSIRTMDTWKNTNGLLSS--YSGAIGVKTGSGPEAKYCLV 225 K K T N NGLL G KTG A Y LV 1hd8a.pdb 207 ASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRF 243 1skf.pdb 226 FAATRGGKTVIGTVLASTSIPARESDATKIMNYGFAL 262 AT G I V RE K GF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################