################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:27:53 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Phage_lysozyme.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1k28a.pdb # 2: 1l58.pdb # # Length: 173 # Identity: 72/173 ( 41.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 72/173 ( 41.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/173 ( 5.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1k28a.pdb 1 DNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREI 60 1l58.pdb 1 ----MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLN--AAKSELDKAIGRNC 54 M EMLR DEGLRLK Y DTEGY TIGIGHL K P L K GR 1k28a.pdb 61 TGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGV 120 1l58.pdb 55 N---GVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGV 111 G IT EA LF D R I K PV R AL NM FQMG GV 1k28a.pdb 121 AKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVE 173 1l58.pdb 112 AGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTANRAKRVITTFRTGTWDAYKNL 164 A F L W A S WY QT RA RV TG Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################