################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 09:21:26 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Propep_M14.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: 1aye.pdb # 2: 1nsa.pdb # 3: 1pca.pdb # 4: 1pyta.pdb # # Length: 100 # Identity: 20/100 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/100 ( 51.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/100 ( 17.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1aye.pdb 1 LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSP-----TTPGETAHVRVPFVN 55 1nsa.pdb 1 ---FEGEKVFRVNVEDENDISELHELAST--RQIDFWKP-DSVTQIKPHSTVDFRVKAED 54 1pca.pdb 1 KEDFVGHQVLRISVDDEAQVQKVKELEDLEHLQLDFWRGP-----ARPGFPIDVRVPFPS 55 1pyta.pdb 1 KEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGP-----GQPGSPIDVRVPFPS 55 FvG qVlri dE eLe lQlDFW Pg dvRVpf 1aye.pdb 56 VQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRR- 94 1nsa.pdb 55 ILAVEDFLEQNELQYEVLINNLRSVLEAQFDSVS-----R 89 1pca.pdb 56 IQAVKVFLEAHGIRYTIMIEDVQLLLDEEQEQMFASQGR- 94 1pyta.pdb 56 LQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSR- 94 qAVkvFLE gi Y imIedvq lLd e e m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################