################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:58:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/RHD.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1a3qa.pdb # 2: 1nfka.pdb # # Length: 313 # Identity: 170/313 ( 54.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 170/313 ( 54.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/313 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1a3qa.pdb 1 GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLV 60 1nfka.pdb 1 GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLV 60 GPYL I EQPKQRGFRFRY CEGPSHGGLPGASSEK K YP VKICNY GPAK V LV 1a3qa.pdb 61 THSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQR 120 1nfka.pdb 61 TNGKNIHLHAHSLVGKHCE-DGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTE 119 T HAHSLVGK C G C V GPKDM F NLG LHVTKK T 1a3qa.pdb 121 QRLRS-------------------RPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAF 161 1nfka.pdb 120 ACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAF 179 R LT E Q A K MDLS VRL F AF 1a3qa.pdb 162 LR------SLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDD 215 1nfka.pdb 180 LPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD 239 L L PV S I DSK P ASNLKI RMD TAG V GG E YLLCDKVQKDD 1a3qa.pdb 216 IEVRFYEDD-E-NGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGG 273 1nfka.pdb 240 IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDL 299 I RFYE W FGDFSPTDVH Q AIVF TP Y I P VF QL RK 1a3qa.pdb 274 DVSDSKQFTYYP- 285 1nfka.pdb 300 ETSEPKPFLYYPE 312 S K F YYP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################