################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 22:59:30 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Rho_GDI.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ds6b.pdb # 2: 1rhoa.pdb # # Length: 179 # Identity: 103/179 ( 57.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 103/179 ( 57.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 37/179 ( 20.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ds6b.pdb 1 GNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPG 60 1rhoa.pdb 1 -------------------------------VAV--SAD-PNVPNVVVTGLTLVCSSAPG 26 P PNVVVT LTLVC SAPG 1ds6b.pdb 61 PITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATF 120 1rhoa.pdb 27 PLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSG-KYIEHTYRKGVKIDKTDY 85 P DLTGDLE KK VLKEG EYR KI F VNR IVSG KY HTYR GVK DK 1ds6b.pdb 121 MVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWG 179 1rhoa.pdb 86 -VGSYGPRAEEYEFLTPVEEAPKG-LARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWK 142 VGSYGPR EEYEFLTPVEEAPKG LARG Y KS FTDDDK DHLSWEWNL IKK W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################