################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:03:18 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_L18p.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1ilya.pdb # 2: 1jj2m.pdb # # Length: 187 # Identity: 26/187 ( 13.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/187 ( 13.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 98/187 ( 52.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1ilya.pdb 1 ------------------------------RLRLSVFRSLKHIYAQIIDDE-K-GVTLVS 28 1jj2m.pdb 1 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLAS 60 RL S KH AQ TL S 1ilya.pdb 29 ASSLALK---LKGN--KTEVARQVGRALAEKALALGIKQVAFDRGPYKY---HGRVKALA 80 1jj2m.pdb 61 AHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGS-KVFAIQ 119 A S L A G A G D G V A 1ilya.pdb 81 EGAREGGLEF-------------------------------------------------- 90 1jj2m.pdb 120 EGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETL 179 EGA GL 1ilya.pdb ------- 1jj2m.pdb 180 LDGDIEL 186 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################