################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 04:19:29 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/SRF-TF.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1egwa.pdb # 2: 1mnma.pdb # 3: 1srsa.pdb # # Length: 87 # Identity: 20/ 87 ( 23.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/ 87 ( 60.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 87 ( 19.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1egwa.pdb 1 -G---RKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQY 56 1mnma.pdb 1 --QKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTF 58 1srsa.pdb 1 TR--GRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTF 58 R KI i fI nk rR vTFsKRK GiMKKAyELSvLtgtqvlLlv setg vytf 1egwa.pdb 57 AST-DMDKVLL-KYTEY---------- 71 1mnma.pdb 59 STPKFEPIVTQQEGRNLIQACLNAPDD 85 1srsa.pdb 59 ATRKLQPMITSETGKALIQTCLNSPD- 84 at p vt g l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################