################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:31:05 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/TIMP.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1br9.pdb # 2: 1ueab.pdb # # Length: 192 # Identity: 74/192 ( 38.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 74/192 ( 38.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/192 ( 10.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1br9.pdb 1 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPI-KRIQYEIKQIKMFKGPEK- 58 1ueab.pdb 1 CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQ-T-------TLYQRYEIKMTKMYKGF-QA 51 C C P HPQ AFCN D VIRAK V EV YEIK KM KG 1br9.pdb 59 -----DIEFIYTAPSSAVCGVSLD--VGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLS 111 1ueab.pdb 52 LGDAADIRFVYTPAMESVCGYFHRSHA-RSEEFLIAGKLQD-GLLHITTCSFVAPWNSLS 109 DI F YT VCG E LIAGK G HIT C F PW LS 1br9.pdb 112 TTQKKSLNHRYQMGC-ECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKR 170 1ueab.pdb 110 LAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPR 169 Q Y GC EC C IPC S CLW D G Q AC R 1br9.pdb 171 SDGSCAWYRGAA 182 1ueab.pdb 170 EPGLCTWQSLRS 181 G C W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################