################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 00:02:11 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/UCR_14kD.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bgyf.pdb # 2: 1ezvf.pdb # # Length: 126 # Identity: 38/126 ( 30.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/126 ( 30.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/126 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bgyf.pdb 1 A---------------VSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHE-NDDVKEAIR 44 1ezvf.pdb 1 -QSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALR 59 S N AG KLGL DD I E N A R 1bgyf.pdb 45 RLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWA 104 1ezvf.pdb 60 RLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELD 119 RLPE R RI RA LP W K ED YL PY E KE E 1bgyf.pdb 105 KK---- 106 1ezvf.pdb 120 NIEVSK 125 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################