################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 04:42:59 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Yers_vir_YopE.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1g4wr.pdb # 2: 1he1a.pdb # 3: 1hy5a.pdb # # Length: 139 # Identity: 8/139 ( 5.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/139 ( 34.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 50/139 ( 36.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1g4wr.pdb 1 ----------------LLDIALKGLKRTLPQLEQMDGNSL-R----------PLRSLMTN 33 1he1a.pdb 1 --ASSAVVFKQMVLQQALPMT-LKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTA 57 1hy5a.pdb 1 TS----------FSDSIKQLA-AETLPKYQQLNSLDAE-LQKNHDQFATGSGPLRGSITQ 48 l a l k qL ld e L r pLRsl T 1g4wr.pdb 34 LQNLN----K-QLNDYVTTLTNIQVGVARFSQW-----EVERWVDAS--THELTQAVKKI 81 1he1a.pdb 58 LAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDA-SPELRREITDQL 116 1hy5a.pdb 49 CQGLQ-FC-GGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGV---DLTQAANEI 103 lqgl el a lln vggi fsQW aas V ltqa i 1g4wr.pdb 82 HVIAKELKNVTAELEKI-- 98 1he1a.pdb 117 HQVMSEVALLRQAVESEVS 135 1hy5a.pdb 104 KGLAQQQ-KLLSL------ 115 h a e l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################