################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 18:16:21 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/abhydrolase_2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1auoa.pdb # 2: 1fj2a.pdb # # Length: 233 # Identity: 71/233 ( 30.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 71/233 ( 30.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/233 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1auoa.pdb 1 -------MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAPT 53 1fj2a.pdb 1 MDPEFMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIR--SSHIKYICPHAPV 58 P I A A A VI LHGLG P AP 1auoa.pdb 54 RPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGF 113 1fj2a.pdb 59 RPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGF 118 RPVT N MPSW DI SP A LI GI RI L GF 1auoa.pdb 114 SQGGAVVFHTAFINWQGPLGGVIALSTYAPTFG---DELELSASQQRIPALCLHGQYDDV 170 1fj2a.pdb 119 SQGGALSLYTALT-TQQKLAGVTALSCWLPLRASFPQ-GPIGGANRDISILQCHGDCDPL 176 SQGGA TA Q L GV ALS P I L HG D 1auoa.pdb 171 VQNAMGRSAFEHLKSRG-V-TVTWQ-EYPMGHEVLPQEIHDIGAWLAARLG-- 218 1fj2a.pdb 177 VPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPI 229 V G E LK VT M H QE D L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################