################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Wed Jul 27 12:30:59 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/bowman.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: 1bbi.pdb # 2: 1pbia.pdb # 3: 1pi2.pdb # 4: 1sbwi.pdb # 5: 1tabi.pdb # # Length: 77 # Identity: 8/ 77 ( 10.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 77 ( 11.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 63/ 77 ( 81.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bbi.pdb 1 DD-ESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDIT-DFC 58 1pbia.pdb 1 -----KSACCDTCLCTKSNPPTCRC-VDVGETCHSACLSCICAYSNPPKCQCFDTQ-KFC 53 1pi2.pdb 1 ----YSKPCCDLCMCTRSMPPQCSC-EDRINSCHSDCKSCMCTRSQPGQCRCLDTN-DFC 54 1sbwi.pdb 1 -----------SCRCTKSIPPQCHC----------------------------------- 14 1tabi.pdb 1 --SESSKPCCDQCSCTKSMPPKCRCS---------------------------DIRNDFC 31 C CTkS PP C C 1bbi.pdb 59 YEPCKPSEDDKEN---- 71 1pbia.pdb 54 YKQCH--NSELEEVIKN 68 1pi2.pdb 55 YKPCK--AA-------- 61 1sbwi.pdb ----------------- 1tabi.pdb 32 YEPCK------------ 36 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################