################################################################################################
# Program: MUSTANG-Lite v0.1: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Sat Jul 23 01:31:56 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/cks.html
################################################################################################
#====================================
# Aligned_structures: 3
#   1: 1buhb.pdb
#   2: 1cksa.pdb
#   3: 1puc.pdb
#
# Length:        122
# Identity:       27/122 ( 22.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     49/122 ( 40.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           67/122 ( 54.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


1buhb.pdb               1  ------------------------QIYYSDKYDDEEFEYRHVMLPKDIAKLVP-------   29
1cksa.pdb               1  ---------------------AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVP-------   32
1puc.pdb                1  SKSGVPRLLTASERERLEPFI--DQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPE   58
                                                   QIyYSdkY DeeyEYRHVMLPk   K vP       

1buhb.pdb              30  ---KTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRR---PL-----------P--   70
1cksa.pdb              33  ---KTHLMSEEEWRRLGVQQSLGWVHYMIHEP---------EP-H-IL-----LFR-RPL   72
1puc.pdb               59  TGT-LRILQEEEWRGLGITQSLGWEMYE-V-H---------VPE--PHILLFKREKD---  101
                               thlmsEeEWR LGvqQSlGWvhYm h p                            

1buhb.pdb                  --     
1cksa.pdb              73  PK   74
1puc.pdb                   --     
                             


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################