################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 01:39:28 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/csp.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1c9oa.pdb # 2: 1csp.pdb # 3: 1mjc.pdb # # Length: 70 # Identity: 37/ 70 ( 52.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 70 ( 84.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 70 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1c9oa.pdb 1 --MQRGKVKWFNNEKGYGFIEVE-GGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRG 57 1csp.pdb 1 --MLEGKVKWFNSEKGFGFIEVE-GQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRG 57 1mjc.pdb 1 SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKG 60 m GkVKWFN eKGfGFIeve G DVFVHFsAIQgeGfKtLeEGQ VSFeIv GnrG 1c9oa.pdb 58 PQAANVVKL- 66 1csp.pdb 58 PQAANVTKEA 67 1mjc.pdb 61 PAAGNVTSL- 69 PqAaNVtkl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################