################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 19:41:25 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/eIF-5a.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bkb.pdb # 2: 2eifa.pdb # # Length: 143 # Identity: 58/143 ( 40.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/143 ( 40.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/143 ( 14.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bkb.pdb 1 KWV------STKYVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDG 54 2eifa.pdb 1 ---AAAAAPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEK 57 TK V G LK G YV IDG PC V I SK GKHG AKAR V G F 1bkb.pdb 55 GKRTLSLPVDAQVEVPIIEKFTAQILSVSGDVIQL-D-RDYKTIEVPKYVEEE---AKGR 109 2eifa.pdb 58 VKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELP------IPEGIEG 111 K P VEVPII Q L GD Q D Y T E P 1bkb.pdb 110 LAPGAEVEVWQILDRYKIIRVKG 132 2eifa.pdb 112 LEPGGEVEYIEAVGQYKITRVI- 133 L PG EVE YKI RV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################