################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:37:44 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/hormone.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1axia.pdb # 2: 1huw.pdb # # Length: 182 # Identity: 141/182 ( 77.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 141/182 ( 77.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/182 ( 12.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1axia.pdb 1 T---IPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPS---LCFSESI 54 1huw.pdb 1 -FPTIPLSRLADNAWLRADRLNQLAFDTYQEFEEAYIPKEQIHSFWWNP-QTSLCPSESI 58 IPLSRL DNA LRA RL QLAFDTYQEFEEAYIPKEQ SF NP LC SESI 1axia.pdb 55 PTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLE 114 1huw.pdb 59 PTPSNKEETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLE 118 PTPSN EETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLE 1axia.pdb 115 ERIQTLMGRLTGQIFKQTYSKFDTALLKNYGLLYCFRRDMTYVATYLRIVQCRSVEGSCG 174 1huw.pdb 119 EGIQTLMGRLE-------------ALLKNYGLLYCFNKDMSKVSTYLRTVQCRSVEGSCG 165 E IQTLMGRL ALLKNYGLLYCF DM V TYLR VQCRSVEGSCG 1axia.pdb 175 F- 175 1huw.pdb 166 -F 166 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################