################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 20:43:18 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/il10.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1vlk.pdb # 2: 2ilk.pdb # # Length: 160 # Identity: 128/160 ( 80.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 128/160 ( 80.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/160 ( 14.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1vlk.pdb 1 ----------CDNFPQMLRDLRDAFSRVKTFFQTKDEV-----DNLLLKESLLEDFKGYL 45 2ilk.pdb 1 TQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQ-----MKDQLDNLLLKESLLEDFKGYL 55 N P MLRDLRDAFSRVKTFFQ DNLLLKESLLEDFKGYL 1vlk.pdb 46 GCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKA 105 2ilk.pdb 56 GCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKA 115 GCQALSEMIQFYLEEVMPQAENQDP K HVNSLGENLKTLRLRLRRCHRFLPCENKSKA 1vlk.pdb 106 VEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIK--- 142 2ilk.pdb 116 VEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN 155 VEQ KNAFNKLQEKGIYKAMSEFDIFINYIEAYMT K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################