################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 02:55:56 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/ligase-CoA.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: 1eudb.pdb # 2: 2scub.pdb # 3: 2scud.pdb # # Length: 183 # Identity: 15/183 ( 8.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 83/183 ( 45.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 54/183 ( 29.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1eudb.pdb 1 -----------EPIENEAAKYDLKYI--GLDGNIACFVNGAGLAMATCDIIFLNGGKPAN 47 2scub.pdb 1 -----------DPREAQAAQWELNYV--ALDGNIGCMVNGAGLAMGTMDIVKLHGGEPAN 47 2scud.pdb 1 NCPGVITPGEC-------KIGIQPGHIH-KPGKVGIVSRSGTLTYEAVKQTTDYGFGQST 52 a l y ldGnigc vngagLam t di l Gg pan 1eudb.pdb 48 FLDLGGG--VKESQVYQAFKLLTADPKVEAILVNIFGGIVN-AIIANGITKA-RELELKV 103 2scub.pdb 48 FLDVGGG--ATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNV 105 2scud.pdb 53 CVGIGGDPIPGS-NFIDILEMFEKDPQTEAIVMIGEIGGS----AEEEAAAYIKE-HVTK 106 fld GGg v afk DpkveAilvnifgGiv ia gi a E v v 1eudb.pdb 104 PLVVRLEGT-------------------NVHEAQNILTNSGLPITSAVDLEDAAKKAVAS 144 2scub.pdb 106 PVVVRLEGN-------------------NAELGAKKLADSGLNIIAAKGLTDAAQQVVAA 146 2scud.pdb 107 PVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALE-A-AGVKTVRSLADIGEALKTV 164 PvVvrleG na e L s l i a L Daa va 1eudb.pdb 145 VTK 147 2scub.pdb 147 V-- 147 2scud.pdb --- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################