################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Fri Jul 22 23:02:33 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/ribonuclease_T2.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1bk7a.pdb # 2: 1bola.pdb # # Length: 252 # Identity: 45/252 ( 17.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/252 ( 17.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 92/252 ( 36.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1bk7a.pdb 1 -----------------------FDSFWFVQQWPP-AVCSFQKSGSCPGSG--LRTFTIH 34 1bola.pdb 1 SSCSSTALSCSNSANSDTCCSPEYGLVVLNMQWAPGY--------------GPDNAFTLH 46 QW P FT H 1bk7a.pdb 35 GLWPQQSGT-SLTNCPGSPF-------------D-ITKISHLQSQLNTLWPNVLRANNQQ 79 1bola.pdb 47 GLWPDKCSGAYAP-SG----GCDSNRASSSIASVIKSKDSSLYNSMLTYWPSN-QGNNNV 100 GLWP K S L T WP NN 1bk7a.pdb 80 FWSHEWTKHGTCSESTF--------------NQAAYFKLAVDMRNNYDIIGALRPHAAGP 125 1bola.pdb 101 FWSHEWSKHGTCVS---TYDPDCYDNYEEGEDIVDYFQKAMDLRSQYNVYKAFSSNGITP 157 FWSHEW KHGTC YF A D R Y A P 1bk7a.pdb 126 NGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQD-G--STLIDCTRD 182 1bola.pdb 158 G-GTYTATEMQSAIESYFGAKAKIDCSS------GTLSDVALYFYVRGRDTYVITDALST 210 T FG C L V F D 1bk7a.pdb 183 TC-GANFIF--- 190 1bola.pdb 211 GSCSGDVEYPTK 222 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################