################################################################################################ # Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey # Rundate: Sat Jul 23 00:10:16 2005 # Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/vprotease.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: 1vcpa.pdb # 2: 1wyka.pdb # # Length: 152 # Identity: 98/152 ( 64.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 98/152 ( 64.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/152 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= 1vcpa.pdb 1 -CIFEVKHE-GKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSKYDLECAQIPVH 58 1wyka.pdb 1 MRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVN 60 F VK E G V G A KVMKP HVKG ID L KL F KSS YD E AQ PV 1vcpa.pdb 59 MRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLG 118 1wyka.pdb 61 MRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLG 120 MRS A YT E PEG YNWHHGAVQYSGGRFTIP G G GDSGRPI DN GRVVAIVLG 1vcpa.pdb 119 GANEGSRTALSVVTWNKDMVTRVTPEGSEEW- 149 1wyka.pdb 121 GADEGTRTALSVVTWNSKGKTIKTTPEGTEEW 152 GA EG RTALSVVTWN T T E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################